Flow stage update by cuff on 21 Aug 2007 12:51
nice chopping
PDB Chain: 1pyiA
1pyiA
PDB 1pyi, Chain A
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 1pyiA01 | Not yet assigned |
Chain ATOM Sequence
>pdb|1pyiA SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATS DDEPFDLK
Chain History Events (30)
Chain chopped by cuff on 21 Aug 2007 12:51
nice chopping
Domchop review by tronnberg on 16 Jul 2007 11:41
Flow stage update by tronnberg on 16 Jul 2007 11:41
Chain chopping manual by tronnberg on 16 Jul 2007 11:41
Domchop allotment by tronnberg on 16 Jul 2007 10:48
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 16 Jul 2007 10:48
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 14 Jul 2007 12:18
Retrieved HMM(SAM) results for job ID SID7897450222480496 and inserted them into the database.
Chain chopping hmm by auto on 14 Jul 2007 12:18
Chain HMM chopping
Update comment by auto on 14 Jul 2007 05:59
HMM(SAM) job SID7897450222480496 is not yet finished.
Hmm submit by auto on 14 Jul 2007 05:55
The entry "1pyiA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 Jul 2007 05:55
The entry "1pyiA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 Jul 2007 05:28
Retrieved "1pyiA" CATHEDRAL results for job ID SID1731420297687168 and inserted them into the database.
Chain chopping cathedral by auto on 14 Jul 2007 05:28
Chain "1pyiA" CATHEDRAL chopping from job SID1731420297687168
Cathedral submit by auto on 14 Jul 2007 01:32
The entry "1pyiA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 14 Jul 2007 01:32
The entry "1pyiA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 Jul 2007 23:51
ScanList with 9336 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1pyiA.scanlist" for "1pyiA"
Update comment by auto on 13 Jul 2007 18:32
Waiting for 2347 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Chain chopping puu by auto on 13 Jul 2007 16:33
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 13 Jul 2007 16:33
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "1pyiA"
Chain chopping domak by auto on 13 Jul 2007 16:33
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 13 Jul 2007 16:10
Number of chains in ballcock flow stages is 123 which is less than the max allowed of 400
Flow stage update by auto on 12 Jul 2007 21:00
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 12 Jul 2007 21:00
Putative ChopClose added based on similarity with "2fa8D"
Flow stage update by auto on 12 Jul 2007 20:38
No in_process hits for Chain "1pyiA" ready to be processed
Flow stage update by auto on 12 Jul 2007 20:30
NW result present for Chain "1pyiA"
Flow stage update by auto on 12 Jul 2007 20:05
All required files are present for Chain "1pyiA"
Flow stage update by auto on 12 Jul 2007 19:57
Beginning processing for Chain "1pyiA"
Flow stage update by auto on 23 Feb 2007 17:27
Chain passed the SIFT criteria
Insertion by auto on 05 Mar 2006 13:53
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"
