PDB Chain: 1pueE

Molscript image for 1pueE
1pueE
PDB coordinates for chain 1pueE

PDB 1pue, Chain E

CATH Domains (1)

Domain IDCATH codeImage
1pueE00 1.10.10.10 Molscript image for 1pueE00

[top]
Domain boundaries for PDB chain 1pueE

Chopping figure for chain 1pueE
Domain IDStart ResStop Res NameLength
1pueE00 171 258 88

[top]
Chain ATOM Sequence 

>pdb|1pueE
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKL
TYQFSGEV
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1pueE
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKL
TYQFSGEVL
BLAST against CATH

[top]
Chain History Events (6)

Property update by auto on 08 Nov 2007 00:27

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.880920162381597" to "0.880758807588076"]

Property update by auto on 14 Jul 2006 14:47

Updated the chain's properties [modified "combs_md5_code" from "c1f4ee22ba8885aedd78392bc2e62c30" to "44bc135ff2e3b17ab72c1cba56326eff"] [modified "seqres_md5_code" from "c1f4ee22ba8885aedd78392bc2e62c30" to "44bc135ff2e3b17ab72c1cba56326eff"]

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:26

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"