PDB Chain: 1perL

Molscript image for 1perL
1perL
PDB coordinates for chain 1perL

PDB 1per, Chain L

CATH Domains (1)

Domain IDCATH codeImage
1perL00 1.10.260.40 Molscript image for 1perL00

Domain boundaries for PDB chain 1perL

Chain ATOM Sequence

>pdb|1perL
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT    

Chain COMBS Sequence

>pdb|1perL
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR    

Chain History Events (5)

Property update by auto on 14 Jul 2006 14:45

Updated the chain's properties [modified "combs_md5_code" from "54bc3485fc7d00028a18d813279717e0" to "c2239521fff61058ce1bdf2de5bd0c74"] [modified "seqres_md5_code" from "54bc3485fc7d00028a18d813279717e0" to "c2239521fff61058ce1bdf2de5bd0c74"]

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:26

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"