PDB Chain: 1mdyA

Molscript image for 1mdyA
1mdyA
PDB coordinates for chain 1mdyA

PDB 1mdy, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1mdyA00 4.10.280.10 Molscript image for 1mdyA00

[top]
Domain boundaries for PDB chain 1mdyA

Chopping figure for chain 1mdyA
Domain IDStart ResStop Res NameLength
1mdyA00 1 166 68

[top]
Chain ATOM Sequence 

>pdb|1mdyA
MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1mdyA
MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:19

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"