PDB Chain: 1ihfB

Molscript image for 1ihfB
1ihfB
PDB coordinates for chain 1ihfB

PDB 1ihf, Chain B

CATH Domains (1)

Domain IDCATH codeImage
1ihfB00 4.10.520.10 Molscript image for 1ihfB00

[top]
Domain boundaries for PDB chain 1ihfB

Chopping figure for chain 1ihfB
Domain IDStart ResStop Res NameLength
1ihfB00 1 94 94

[top]
Chain ATOM Sequence 

>pdb|1ihfB
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF
KPGKELRDRANIYG
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1ihfB
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF
KPGKELRDRANIYG
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:11

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"