PDB Chain: 1ihfA

Molscript image for 1ihfA
1ihfA
PDB coordinates for chain 1ihfA

PDB 1ihf, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1ihfA00 4.10.520.10 Molscript image for 1ihfA00

[top]
Domain boundaries for PDB chain 1ihfA

Chopping figure for chain 1ihfA
Domain IDStart ResStop Res NameLength
1ihfA00 2 97 96

[top]
Chain ATOM Sequence 

>pdb|1ihfA
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTF
RPGQKLKSRVENASPK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1ihfA
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVT
FRPGQKLKSRVENASPKDE
BLAST against CATH

[top]
Chain History Events (6)

Property update by auto on 07 Nov 2007 23:34

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.900518134715026" to "0.9002079002079"]

Property update by auto on 14 Jul 2006 14:06

Updated the chain's properties [modified "combs_md5_code" from "496be32dfabd4179c930d141ac193b0f" to "59ec5d46b9f3ed5fc9297c10221bdeba"] [modified "seqres_md5_code" from "496be32dfabd4179c930d141ac193b0f" to "59ec5d46b9f3ed5fc9297c10221bdeba"]

Flow stage update by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:11

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"