Flow stage update by lewis on 18 Jan 2007 19:29
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
| Domain ID | CATH code | Image |
|---|---|---|
| 1ignA01 | 1.10.10.60 | |
| 1ignA02 | 1.10.10.60 |
>pdb|1ignA KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTK VLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLL AYGIDDYISYYEAEEPMKNLTPTPGNYNS
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.
Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.
Updated the chain's properties [modified "combs_md5_code" from "6fc550405a427a8fae6ee10647ee4db9" to "ec278aedbf28408c677b09aaca80a726"] [modified "seqres_md5_code" from "6fc550405a427a8fae6ee10647ee4db9" to "9f414c2d7774b4a1f15836ad7b0696e3"]
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain passed the SIFT criteria
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"