PDB Chain: 1hryA

Molscript image for 1hryA
1hryA
PDB coordinates for chain 1hryA

PDB 1hry, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1hryA00 1.10.30.10 Molscript image for 1hryA00

[top]
Domain boundaries for PDB chain 1hryA

Chopping figure for chain 1hryA
Domain IDStart ResStop Res NameLength
1hryA00 3 75 73

[top]
Chain ATOM Sequence 

>pdb|1hryA
DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1hryA
VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRP
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 14:03

Updated the chain's properties [modified "combs_md5_code" from "bf9583c7f1186ca407b6737c19d4545e" to "a533a032e3cd45be478f43362cfd92ab"] [modified "seqres_md5_code" from "bf9583c7f1186ca407b6737c19d4545e" to "a533a032e3cd45be478f43362cfd92ab"]

Flow stage update by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:10

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"