PDB Chain: 1hcqA

Molscript image for 1hcqA
1hcqA
PDB coordinates for chain 1hcqA

PDB 1hcq, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1hcqA00 3.30.50.10 Molscript image for 1hcqA00

Domain boundaries for PDB chain 1hcqA

Chain ATOM Sequence

>pdb|1hcqA
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMK    

Chain COMBS Sequence

>pdb|1hcqA
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD
RRGG    

Chain History Events (5)

Property update by auto on 14 Jul 2006 14:01

Updated the chain's properties [modified "combs_md5_code" from "e8c31eef9ef4fff3ff398d532c40eea2" to "3b006b6a1889a5863bcb900d32a69ade"] [modified "seqres_md5_code" from "e8c31eef9ef4fff3ff398d532c40eea2" to "3b006b6a1889a5863bcb900d32a69ade"]

Flow stage update by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:09

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"