PDB Chain: 1gatA

Molscript image for 1gatA
1gatA
PDB coordinates for chain 1gatA

PDB 1gat, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1gatA00 3.30.50.10 Molscript image for 1gatA00

Domain boundaries for PDB chain 1gatA

Chain ATOM Sequence

>pdb|1gatA
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS    

Chain COMBS Sequence

>pdb|1gatA
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS    

Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:06

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"