PDB Chain: 1fjlA

Molscript image for 1fjlA
1fjlA
PDB coordinates for chain 1fjlA

PDB 1fjl, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1fjlA00 1.10.10.60 Molscript image for 1fjlA00

[top]
Domain boundaries for PDB chain 1fjlA

Chopping figure for chain 1fjlA
Domain IDStart ResStop Res NameLength
1fjlA00 0 64 65

[top]
Chain ATOM Sequence 

>pdb|1fjlA
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1fjlA
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
BLAST against CATH

[top]
Chain History Events (6)

Property update by auto on 07 Nov 2007 23:08

Updated the chain's properties [modified "seqres_md5_code" from "21eb296e5a681415bb2afac55d7ffafb" to "6211c32210d46346d9897357c9179b24"]

Property update by auto on 14 Jul 2006 13:51

Updated the chain's properties [modified "seqres_md5_code" from "ab3be8efba95030b3b063bc3bad94d8c" to "21eb296e5a681415bb2afac55d7ffafb"]

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:04

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"