PDB Chain: 1dp7P

Molscript image for 1dp7P
1dp7P
PDB coordinates for chain 1dp7P

PDB 1dp7, Chain P

CATH Domains (1)

Domain IDCATH codeImage
1dp7P00 1.10.10.10 Molscript image for 1dp7P00

[top]
Domain boundaries for PDB chain 1dp7P

Chopping figure for chain 1dp7P
Domain IDStart ResStop Res NameLength
1dp7P00 1 76 76

[top]
Chain ATOM Sequence 

>pdb|1dp7P
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1dp7P
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:01

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"