PDB Chain: 1d02A

Molscript image for 1d02A
1d02A
PDB coordinates for chain 1d02A

PDB 1d02, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1d02A00 3.40.580.10 Molscript image for 1d02A00

[top]
Domain boundaries for PDB chain 1d02A

Chopping figure for chain 1d02A
Domain IDStart ResStop Res NameLength
1d02A00 6 202 197

[top]
Chain ATOM Sequence 

>pdb|1d02A
LSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQVVLPDDVIKEIFNPLIDLSTTQWGVSPAFA
IENTETHKILFGEIKRQDGWVEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGDITRDPKRVRE
ITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1d02A
MGKSELSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQVVLPDDVIKEIFNPLIDLSTTQWGV
SPAFAIENTETHKILFGEIKRQDGWVEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGDITRDP
KRVREITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 13:40

Updated the chain's properties [modified "combs_md5_code" from "95a65f2f8b16cd2d5ccc0d2b33fdc665" to "2ad161b400fc227aa136a871ee78b871"] [modified "seqres_md5_code" from "95a65f2f8b16cd2d5ccc0d2b33fdc665" to "2ad161b400fc227aa136a871ee78b871"]

Flow stage update by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:59

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"