PDB Chain: 1cjgA

Molscript image for 1cjgA
1cjgA
PDB coordinates for chain 1cjgA

PDB 1cjg, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1cjgA00 1.10.260.40 Molscript image for 1cjgA00

[top]
Domain boundaries for PDB chain 1cjgA

Chopping figure for chain 1cjgA
Domain IDStart ResStop Res NameLength
1cjgA00 1 62 62

[top]
Chain ATOM Sequence 

>pdb|1cjgA
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1cjgA
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSL
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:59

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"