PDB Chain: 1cf7A

Molscript image for 1cf7A
1cf7A
PDB coordinates for chain 1cf7A

PDB 1cf7, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1cf7A00 1.10.10.10 Molscript image for 1cf7A00

Domain boundaries for PDB chain 1cf7A

Chain ATOM Sequence

>pdb|1cf7A
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK    

Chain COMBS Sequence

>pdb|1cf7A
PPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGP    

Chain History Events (5)

Property update by auto on 14 Jul 2006 13:38

Updated the chain's properties [modified "combs_md5_code" from "32f9dca98b303a005e04eb1aced3d32d" to "db568cd61f578de87bf86db343d3f2f5"] [modified "seqres_md5_code" from "32f9dca98b303a005e04eb1aced3d32d" to "db568cd61f578de87bf86db343d3f2f5"]

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:58

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"