PDB Chain: 1cdwA

Molscript image for 1cdwA
1cdwA
PDB coordinates for chain 1cdwA

PDB 1cdw, Chain A

CATH Domains (2)

Domain IDCATH codeImage
1cdwA01 3.30.310.10 Molscript image for 1cdwA01
1cdwA02 3.30.310.10 Molscript image for 1cdwA02

[top]
Domain boundaries for PDB chain 1cdwA

Chopping figure for chain 1cdwA
Domain IDStart ResStop Res NameLength
1cdwA01 155 165 11
1cdwA01 252 333 82
1cdwA02 166 251 86

[top]
Chain ATOM Sequence 

>pdb|1cdwA
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYA
RVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVR
AEIYEAFENIYPILKGFRK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1cdwA
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYA
RVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVR
AEIYEAFENIYPILKGFRK
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 16:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:58

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"