Flow stage update by auto on 05 Mar 2006 16:16
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
| Domain ID | CATH code | Image |
|---|---|---|
| 1cdwA01 | 3.30.310.10 | |
| 1cdwA02 | 3.30.310.10 |
>pdb|1cdwA SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYA RVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVR AEIYEAFENIYPILKGFRK
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain passed the SIFT criteria
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"