PDB Chain: 1c0wB

Molscript image for 1c0wB
1c0wB
PDB coordinates for chain 1c0wB

PDB 1c0w, Chain B

CATH Domains (3)

Domain IDCATH codeImage
1c0wB01 1.10.10.10 Molscript image for 1c0wB01
1c0wB02 1.10.60.10 Molscript image for 1c0wB02
1c0wB03 Not yet assigned Molscript image for 1c0wB03

[top]
Domain boundaries for PDB chain 1c0wB

Chopping figure for chain 1c0wB
Domain IDStart ResStop Res NameLength
1c0wB01 2 73 72
1c0wB02 74 140 67
1c0wB03 147 226 80

[top]
Chain ATOM Sequence 

>pdb|1c0wB
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRL
AERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQ
INEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1c0wB
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRL
AERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAAPGTRVIDAATSMPR
KVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
BLAST against CATH

[top]
Chain History Events (14)

Flow stage update by auto on 18 Aug 2007 18:29

Final ChopClose added based on similarity with "1fx7A"

Chain chopped by auto on 18 Aug 2007 18:29

Final ChopClose added based on similarity with "1fx7A"

Chain chopping chopclose by auto on 18 Aug 2007 18:28

Putative ChopClose added based on similarity with "1fx7A"

Flow stage update by auto on 18 Aug 2007 18:26

No in_process hits for Chain "1c0wB" ready to be processed

Update comment by auto on 18 Aug 2007 18:22

Chain "1c0wB" hits Chain "1c0wD" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 10:03

Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 17:40

Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process

Update comment by auto on 12 Jul 2007 20:51

Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:38

Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:30

NW result present for Chain "1c0wB"

Flow stage update by auto on 12 Jul 2007 20:05

All required files are present for Chain "1c0wB"

Flow stage update by auto on 12 Jul 2007 19:57

Beginning processing for Chain "1c0wB"

Flow stage update by auto on 23 Feb 2007 17:26

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:43

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"