Flow stage update by auto on 18 Aug 2007 18:29
Final ChopClose added based on similarity with "1fx7A"
| Domain ID | CATH code | Image |
|---|---|---|
| 1c0wB01 | 1.10.10.10 | |
| 1c0wB02 | 1.10.60.10 | |
| 1c0wB03 | Not yet assigned |
>pdb|1c0wB KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRL AERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVAPGTRVIDAATSMPRKVRIVQ INEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Final ChopClose added based on similarity with "1fx7A"
Final ChopClose added based on similarity with "1fx7A"
Putative ChopClose added based on similarity with "1fx7A"
No in_process hits for Chain "1c0wB" ready to be processed
Chain "1c0wB" hits Chain "1c0wD" (100% over 100%) which is currently in process
Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process
Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process
Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process
Chain "1c0wB" hits Chain "1c0wA" (100% over 100%) which is currently in process
NW result present for Chain "1c0wB"
All required files are present for Chain "1c0wB"
Beginning processing for Chain "1c0wB"
Chain passed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"