PDB Chain: 1bl0A

Molscript image for 1bl0A
1bl0A
PDB coordinates for chain 1bl0A

PDB 1bl0, Chain A

CATH Domains (2)

Domain IDCATH codeImage
1bl0A01 1.10.10.60 Molscript image for 1bl0A01
1bl0A02 1.10.10.60 Molscript image for 1bl0A02

[top]
Domain boundaries for PDB chain 1bl0A

Chopping figure for chain 1bl0A
Domain IDStart ResStop Res NameLength
1bl0A01 9 64 56
1bl0A02 65 124 60

[top]
Chain ATOM Sequence 

>pdb|1bl0A
DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGF
ESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1bl0A
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPIL
YLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 13:34

Updated the chain's properties [modified "combs_md5_code" from "a60f230efc7b481f61efffe89a2cb7b3" to "1f49c95c4cd434b8119ef9a58016442b"] [modified "seqres_md5_code" from "a60f230efc7b481f61efffe89a2cb7b3" to "1f49c95c4cd434b8119ef9a58016442b"]

Flow stage update by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:57

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"