PDB Chain: 1azqA

Molscript image for 1azqA
1azqA
PDB coordinates for chain 1azqA

PDB 1azq, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1azqA00 2.40.50.40 Molscript image for 1azqA00

[top]
Domain boundaries for PDB chain 1azqA

Chopping figure for chain 1azqA
Domain IDStart ResStop Res NameLength
1azqA00 1 66 66

[top]
Chain ATOM Sequence 

>pdb|1azqA
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1azqA
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:56

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"