PDB Chain: 1aayA

Molscript image for 1aayA
1aayA
PDB coordinates for chain 1aayA

PDB 1aay, Chain A

CATH Domains (3)

Domain IDCATH codeImage
1aayA01 3.30.160.60 Molscript image for 1aayA01
1aayA02 3.30.160.60 Molscript image for 1aayA02
1aayA03 3.30.160.60 Molscript image for 1aayA03

[top]
Domain boundaries for PDB chain 1aayA

Chopping figure for chain 1aayA
Domain IDStart ResStop Res NameLength
1aayA01 103 132 30
1aayA02 133 159 27
1aayA03 160 186 27

[top]
Chain ATOM Sequence 

>pdb|1aayA
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHT
KIHLR
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1aayA
MERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKR
HTKIHLRQKD
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 13:29

Updated the chain's properties [modified "combs_md5_code" from "618ad19da9d74d7df6b4337a1248f2ee" to "a51220a4e605c94d844072c7b803a8ca"] [modified "seqres_md5_code" from "618ad19da9d74d7df6b4337a1248f2ee" to "a51220a4e605c94d844072c7b803a8ca"]

Flow stage update by auto on 05 Mar 2006 16:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:54

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"